Domain Names: madisonparkmassage - madisonparkshops

IP Address Domain ISP Location
184.168.221.77 madisonparkmassage.com GoDaddy.com, Inc. Scottsdale, Arizona, USA
50.63.202.75 madisonparkmercantile.com Frontier Communications of America, Inc. USA
205.178.189.129 madisonparkmgmt.net InQuent Technologies Inc. Herndon, Virginia, USA
23.253.128.172 madisonparknaples.com Internet Assigned Numbers Authority Reserved
68.178.232.100 madisonparknaples.info Go Daddy Software, Inc. Scottsdale, Arizona, USA
97.74.215.216 madisonparknaplesflorida.com GoDaddy.com, Inc. Scottsdale, Arizona, USA
74.86.159.23 madisonparkneighbors.com SoftLayer Technologies Inc. Dallas, Texas, USA
50.56.53.125 madisonparknewjersey.com Frontier Communications of America, Inc. USA
207.148.213.218 madisonparknews.com Bullseye Telecom Clawson, Michigan, USA
208.73.210.29 madisonparknj.com Oversee.net Los Angeles, California, USA
192.185.151.111 madisonparkofenterprise.com Bull HN Information Systems, Inc. Chelmsford, Massachusetts, USA
50.63.202.91 madisonparkopenhouses.com Frontier Communications of America, Inc. USA
64.202.163.94 madisonparkoptions.com Go Daddy Software, Inc. Scottsdale, Arizona, USA
69.89.31.218 madisonparkparents.com Bluehost Inc. Provo, Utah, USA
205.178.152.154 madisonparkpartners.com InQuent Technologies Inc. Herndon, Virginia, USA
216.39.57.107 madisonparkpartners.net AltaVista Company Sunnyvale, California, USA
216.39.57.107 madisonparkpartners.org AltaVista Company Sunnyvale, California, USA
69.89.27.209 madisonparkpictures.com Bluehost Inc. Provo, Utah, USA
54.243.215.197 madisonparkprek.com Merck and Co., Inc. USA
54.243.215.197 madisonparkprek.org Merck and Co., Inc. USA
50.63.202.22 madisonparkpremierproperties.com Frontier Communications of America, Inc. USA
54.243.215.197 madisonparkpreschool.com Merck and Co., Inc. USA
54.243.215.197 madisonparkpreschool.org Merck and Co., Inc. USA
50.63.202.17 madisonparkpreview.com Frontier Communications of America, Inc. USA
98.129.229.15 madisonparkproductions.com Rackspace.com, Ltd. San Antonio, Texas, USA
66.96.161.155 madisonparkpropertyvalues.com Net//works!, Inc. Burlington, Massachusetts, USA
72.167.191.69 madisonparkpt.com GoDaddy.com, Inc. Scottsdale, Arizona, USA
50.62.141.196 madisonparkrealestate.com Frontier Communications of America, Inc. USA
50.63.202.62 madisonparkrealestate.info Frontier Communications of America, Inc. USA
69.46.40.100 madisonparkrealtor.com Transglobal Internet, Inc. Lynnwood, Washington, USA
76.74.252.199 madisonparkrealty.com SwitchWorks Technologies Inc. San Antonio, Texas, USA
69.90.45.40 madisonparkrentals.com Peer 1 Network Inc. Vancouver, British Columbia, Canada
64.74.223.42 madisonparkreston.com Super Computer Bellevue, Washington, USA
209.17.171.199 madisonparkreunion.com GT Group Telecom Services Corp. Vancouver, British Columbia, Canada
64.74.223.48 madisonparkrvtcardinals.com Super Computer Bellevue, Washington, USA
8.5.1.46 madisonparkrvtmckinleyrvtfenwaycardinals.com Genuity Bellevue, Washington, USA
216.24.4.75 madisonparks.com WinNET Communications Louisville, Kentucky, USA
64.202.189.170 madisonparksanta.com Go Daddy Software, Inc. Scottsdale, Arizona, USA
208.48.81.133 madisonparkschool.com Savvis Brisbane, Queensland, Australia
72.167.183.100 madisonparkseasons.com GoDaddy.com, Inc. Scottsdale, Arizona, USA
199.115.114.41 madisonparkseattle.com North Central Pennsylvania Regional Planning and Development Commission Ridgway, Pennsylvania, USA
68.178.232.100 madisonparkseattlehomes.com Go Daddy Software, Inc. Scottsdale, Arizona, USA
208.91.197.27 madisonparksec.com Extremeware Inc. Miami, Florida, USA
208.91.197.27 madisonparksec.net Extremeware Inc. Miami, Florida, USA
208.91.197.27 madisonparksecurities.com Extremeware Inc. Miami, Florida, USA
208.91.197.27 madisonparksecurities.net Extremeware Inc. Miami, Florida, USA
205.178.189.129 madisonparksecuritiesllc.com InQuent Technologies Inc. Herndon, Virginia, USA
208.91.197.27 madisonparksecuritiesllc.net Extremeware Inc. Miami, Florida, USA
141.8.224.239 madisonparksermons.com Deutsches Forschungsnetz Berlin, Germany
216.155.154.212 madisonparksfoundation.org Onondaga Beverage Company Sayreville, New Jersey, USA
205.234.236.86 madisonparkshops.com Server Central Network Chicago, Illinois, USA
Plot IP

Your IP Address is 3.236.100.6