Domain Names: searchenginemarketin... - searchenginemarketin...

IP Address Domain ISP Location
68.178.232.143 searchenginemarketinglasvegas.com Go Daddy Software, Inc. Scottsdale, Arizona, USA
216.239.32.21 searchenginemarketinglead.com Google Inc. Mountain View, California, USA
50.63.202.62 searchenginemarketingleads.com Frontier Communications of America, Inc. USA
208.66.72.186 searchenginemarketinglink.info R & D Technologies, LLC Las Vegas, Nevada, USA
62.140.213.189 searchenginemarketinglist.com London office main assignment London, United Kingdom
82.98.86.165 searchenginemarketingllc.com PlusLine Systemhaus GmbH Frankfurt Am Main, Hessen, Germany
69.64.156.208 searchenginemarketinglogic.com eNom! Bellevue, Washington, USA
212.84.173.4 searchenginemarketinglondon.com Skypay Public Network Camberley, Surrey, United Kingdom
82.165.83.17 searchenginemarketinglondon.info Schlund+Partner AG Germany
68.178.232.143 searchenginemarketinglosangeles.com Go Daddy Software, Inc. Scottsdale, Arizona, USA
72.167.131.105 searchenginemarketinglosangeles.net GoDaddy.com, Inc. Scottsdale, Arizona, USA
174.36.249.3 searchenginemarketinglosangeles.org SoftLayer Technologies Inc. Dallas, Texas, USA
205.145.129.77 searchenginemarketinglouisiana.com Internet Solutions Group, Inc. Flint, Michigan, USA
23.229.239.194 searchenginemarketingltd.com Internet Assigned Numbers Authority Reserved
204.12.52.226 searchenginemarketingmadeeasy.com HostMySite Newark, Delaware, USA
68.178.232.99 searchenginemarketingmagic.com Go Daddy Software, Inc. Scottsdale, Arizona, USA
205.145.129.77 searchenginemarketingmaine.com Internet Solutions Group, Inc. Flint, Michigan, USA
82.98.86.165 searchenginemarketingman.com PlusLine Systemhaus GmbH Frankfurt Am Main, Hessen, Germany
208.91.197.27 searchenginemarketingmanagedservices.com Extremeware Inc. Miami, Florida, USA
72.52.4.119 searchenginemarketingmanagement.com Prolexic Technologies, Inc. Hollywood, Florida, USA
74.117.114.95 searchenginemarketingmanagement.net Parked.com, Ltd. Cayman Islands
184.168.221.104 searchenginemarketingmanager.com GoDaddy.com, Inc. Scottsdale, Arizona, USA
68.178.232.143 searchenginemarketingmanagers.com Go Daddy Software, Inc. Scottsdale, Arizona, USA
79.170.44.123 searchenginemarketingmanchester.com Heart Internet Ltd Nottingham, United Kingdom
74.117.114.68 searchenginemarketingmarketers.com Parked.com, Ltd. Cayman Islands
205.145.129.77 searchenginemarketingmaryland.com Internet Solutions Group, Inc. Flint, Michigan, USA
205.145.129.77 searchenginemarketingmassachusetts.com Internet Solutions Group, Inc. Flint, Michigan, USA
69.73.154.34 searchenginemarketingmassachusetts.info Jaguar Technologies LLC Fulshear, Texas, USA
50.63.202.53 searchenginemarketingmasters.com Frontier Communications of America, Inc. USA
68.178.232.100 searchenginemarketingmasters.net Go Daddy Software, Inc. Scottsdale, Arizona, USA
50.63.202.56 searchenginemarketingmasters.org Frontier Communications of America, Inc. USA
198.145.180.226 searchenginemarketingmastery.com Palin Aquisitions Inc. Vancouver, Washington, USA
64.202.189.170 searchenginemarketingme.com Go Daddy Software, Inc. Scottsdale, Arizona, USA
98.124.198.1 searchenginemarketingmelbourne.com eNom, Incorporated Bellevue, Washington, USA
82.98.86.165 searchenginemarketingmelbourne.net PlusLine Systemhaus GmbH Frankfurt Am Main, Hessen, Germany
174.37.203.156 searchenginemarketingmesa.com SoftLayer Technologies Inc. Dallas, Texas, USA
69.64.147.242 searchenginemarketingmiami.com eNom! Bellevue, Washington, USA
68.178.232.100 searchenginemarketingmiami.info Go Daddy Software, Inc. Scottsdale, Arizona, USA
72.44.91.211 searchenginemarketingmiami.us Future Hosting, LLC Novi, Michigan, USA
12.111.223.70 searchenginemarketingmichigan.com Yellow Book Co. Inc. King Of Prussia, Pennsylvania, USA
68.178.232.100 searchenginemarketingminneapolis.com Go Daddy Software, Inc. Scottsdale, Arizona, USA
205.145.129.77 searchenginemarketingminnesota.com Internet Solutions Group, Inc. Flint, Michigan, USA
205.145.129.77 searchenginemarketingmississippi.com Internet Solutions Group, Inc. Flint, Michigan, USA
205.145.129.77 searchenginemarketingmissouri.com Internet Solutions Group, Inc. Flint, Michigan, USA
184.168.221.96 searchenginemarketingmn.com GoDaddy.com, Inc. Scottsdale, Arizona, USA
64.202.189.170 searchenginemarketingmontana.com Go Daddy Software, Inc. Scottsdale, Arizona, USA
68.178.232.99 searchenginemarketingmyths.com Go Daddy Software, Inc. Scottsdale, Arizona, USA
68.178.232.143 searchenginemarketingnashville.com Go Daddy Software, Inc. Scottsdale, Arizona, USA
64.202.189.170 searchenginemarketingnc.com Go Daddy Software, Inc. Scottsdale, Arizona, USA
205.145.129.77 searchenginemarketingnebraska.com Internet Solutions Group, Inc. Flint, Michigan, USA
95.211.122.249 searchenginemarketingnetherlands.com LeaseWeb B.V. Amsterdam, Noord-Holland, Netherlands
205.145.129.77 searchenginemarketingnevada.com Internet Solutions Group, Inc. Flint, Michigan, USA
205.145.129.77 searchenginemarketingnewhampshire.com Internet Solutions Group, Inc. Flint, Michigan, USA
69.73.154.34 searchenginemarketingnewhampshire.info Jaguar Technologies LLC Fulshear, Texas, USA
205.145.129.77 searchenginemarketingnewjersey.com Internet Solutions Group, Inc. Flint, Michigan, USA
216.104.161.119 searchenginemarketingnewjerseynewyorksem.com TierraNet Inc. San Diego, California, USA
Plot IP

Your IP Address is 3.235.107.209