Domain Names: searchenginemarketin... - searchenginemarketin...

IP Address Domain ISP Location
205.145.129.77 searchenginemarketingnewmexico.com Internet Solutions Group, Inc. Flint, Michigan, USA
74.117.114.84 searchenginemarketingnews.net Parked.com, Ltd. Cayman Islands
74.117.232.9 searchenginemarketingnewsletter.com OnePartner, LLC Duffield, Virginia, USA
209.67.63.174 searchenginemarketingnewyork.com Savvis New York, USA
69.73.154.34 searchenginemarketingnewyork.info Jaguar Technologies LLC Fulshear, Texas, USA
8.5.1.41 searchenginemarketingnewyork.net Genuity Bellevue, Washington, USA
174.120.188.66 searchenginemarketingnewzealand.com ThePlanet.com Internet Services, Inc. Houston, Texas, USA
208.109.50.126 searchenginemarketingnh.com Go Daddy Software Scottsdale, Arizona, USA
174.132.114.2 searchenginemarketingnj.net ThePlanet.com Internet Services, Inc. Houston, Texas, USA
205.145.129.77 searchenginemarketingnorthcarolina.com Internet Solutions Group, Inc. Flint, Michigan, USA
205.145.129.77 searchenginemarketingnorthdakota.com Internet Solutions Group, Inc. Flint, Michigan, USA
74.53.229.130 searchenginemarketingnotes.com ThePlanet.com Internet Services, Inc. Houston, Texas, USA
72.167.232.176 searchenginemarketingnow.com GoDaddy.com, Inc. Scottsdale, Arizona, USA
64.99.64.32 searchenginemarketingny.com Critical Path, Inc. Toronto, Ontario, Canada
68.178.232.99 searchenginemarketingny.net Go Daddy Software, Inc. Scottsdale, Arizona, USA
205.145.129.77 searchenginemarketingohio.com Internet Solutions Group, Inc. Flint, Michigan, USA
205.145.129.77 searchenginemarketingoklahoma.com Internet Solutions Group, Inc. Flint, Michigan, USA
174.129.226.78 searchenginemarketingonline.net Amazon.com, Inc. Seattle, Washington, USA
68.178.232.100 searchenginemarketingonlineadvertising.com Go Daddy Software, Inc. Scottsdale, Arizona, USA
209.126.254.144 searchenginemarketingoptimization.info California Regional Internet, Inc. San Diego, California, USA
207.179.87.189 searchenginemarketingoptimization.net ACD Internet Services Lansing, Michigan, USA
216.239.32.21 searchenginemarketingoptimization.org Google Inc. Mountain View, California, USA
68.178.232.100 searchenginemarketingoptimizationinternet.com Go Daddy Software, Inc. Scottsdale, Arizona, USA
68.178.232.100 searchenginemarketingoptimizationsearchengine.biz Go Daddy Software, Inc. Scottsdale, Arizona, USA
50.63.202.35 searchenginemarketingoptimizationsearchengine.com Frontier Communications of America, Inc. USA
68.178.232.100 searchenginemarketingoptimizationsearchengine.info Go Daddy Software, Inc. Scottsdale, Arizona, USA
68.178.232.100 searchenginemarketingoptimizationsearchengine.net Go Daddy Software, Inc. Scottsdale, Arizona, USA
50.63.202.37 searchenginemarketingoptimizationsearchengine.org Frontier Communications of America, Inc. USA
184.168.221.41 searchenginemarketingoptimizationsearchengine.us GoDaddy.com, Inc. Scottsdale, Arizona, USA
174.120.6.93 searchenginemarketingoptimizationtips.net ThePlanet.com Internet Services, Inc. Houston, Texas, USA
63.251.171.80 searchenginemarketingorangecounty.com Dotster.com Sammamish, Washington, USA
68.178.232.99 searchenginemarketingorangecounty.net Go Daddy Software, Inc. Scottsdale, Arizona, USA
174.120.149.162 searchenginemarketingorangecounty.org ThePlanet.com Internet Services, Inc. Houston, Texas, USA
174.36.138.31 searchenginemarketingoregon.com SoftLayer Technologies Inc. Dallas, Texas, USA
208.73.210.29 searchenginemarketingorganisation.com Oversee.net Los Angeles, California, USA
68.178.232.100 searchenginemarketingorlando.com Go Daddy Software, Inc. Scottsdale, Arizona, USA
69.89.31.112 searchenginemarketingoz.com Bluehost Inc. Provo, Utah, USA
206.212.253.94 searchenginemarketingpackages.info Colostore.com South Bend, Indiana, USA
205.145.129.77 searchenginemarketingpennsylvania.com Internet Solutions Group, Inc. Flint, Michigan, USA
72.44.80.94 searchenginemarketingpeople.com Future Hosting, LLC Novi, Michigan, USA
68.178.232.143 searchenginemarketingphiladelphia.com Go Daddy Software, Inc. Scottsdale, Arizona, USA
64.221.174.221 searchenginemarketingphoenix.com XO Communications Phoenix, Arizona, USA
67.159.54.6 searchenginemarketingphoenix.net FDC Servers.net, LLC Dallas, Texas, USA
209.188.94.88 searchenginemarketingphoenix.org Cogswell Enterprises Inc. Chicago, Illinois, USA
98.129.126.138 searchenginemarketingplacement.com Rackspace.com, Ltd. San Antonio, Texas, USA
66.147.240.181 searchenginemarketingplacement.net Bluehost Inc. Provo, Utah, USA
64.29.151.218 searchenginemarketingplanning.com InternetNamesForBusiness.com Fort Lauderdale, Florida, USA
68.178.232.143 searchenginemarketingpoliticalwebsitedesign.com Go Daddy Software, Inc. Scottsdale, Arizona, USA
50.63.202.87 searchenginemarketingportland.com Frontier Communications of America, Inc. USA
216.246.55.128 searchenginemarketingpower.com Server Central Network Chicago, Illinois, USA
Plot IP

Your IP Address is 18.204.55.168