Domain Names: srideriteshoes - sridevikrishnakumar

IP Address Domain ISP Location
69.43.160.145 srideriteshoes.com Castle Access Inc Australia
208.88.84.154 sriderjuiceplus.com Nsa, Llc. Collierville, Tennessee, USA
72.51.27.51 sriderman.com Peer 1 Network Inc. Burnaby, British Columbia, Canada
208.79.45.23 sriderphotos.com SmugMug, Inc. Mountain View, California, USA
176.61.138.173 srideshaya.com Internet Assigned Numbers Authority Korea Republic of
206.188.192.83 sridesign.com MonsterCommerce, LLC Herndon, Virginia, USA
173.201.233.1 sridesignconsulting.com GoDaddy.com, Inc. Scottsdale, Arizona, USA
69.168.84.101 sridesigngroup.com Adelphia Orem, Utah, USA
209.212.146.8 sridesignlabs.com GigeNET Arlington Heights, Illinois, USA
68.178.232.100 sridesigns.net Go Daddy Software, Inc. Scottsdale, Arizona, USA
72.167.131.159 sridesignteam.com GoDaddy.com, Inc. Scottsdale, Arizona, USA
208.109.78.141 sridesignworks.com Go Daddy Software Scottsdale, Arizona, USA
174.120.120.151 srideva.com ThePlanet.com Internet Services, Inc. Houston, Texas, USA
66.98.145.18 sridevainfo.com Everyones Internet, Inc. Houston, Texas, USA
74.86.183.200 sridevananda.info SoftLayer Technologies Inc. Dallas, Texas, USA
66.96.145.104 sridevarajaagro.com Net//works!, Inc. Burlington, Massachusetts, USA
217.174.249.23 sridevelopment.net UK's largest web hosting company based in Gloucester Gloucester, Gloucestershire, United Kingdom
67.225.178.171 sridevi-industries.com Liquid Web, Inc. Lansing, Michigan, USA
74.220.207.110 sridevi.biz Bluehost Inc. Provo, Utah, USA
185.53.179.11 sridevi.com Internet Assigned Numbers Authority Reserved
64.31.44.3 sridevi.net The Big Net, Inc. Niagara University, New York, USA
199.96.156.236 sridevi.org Amtote International, Inc. Hunt Valley, Maryland, USA
216.21.229.119 sridevi.us Register.com, Inc New York, USA
192.185.116.153 srideviads.com Bull HN Information Systems, Inc. Chelmsford, Massachusetts, USA
50.63.202.37 srideviassociates.com Frontier Communications of America, Inc. USA
74.220.215.59 srideviastrovastu.com Bluehost Inc. Provo, Utah, USA
66.90.103.81 srideviawasiyavidyapeeth.com SharkTECH.net Woodstock, Illinois, USA
173.236.40.122 sridevibuilders.com SingleHop, Inc. Chicago, Illinois, USA
68.178.232.99 srideviconstructions.com Go Daddy Software, Inc. Scottsdale, Arizona, USA
141.8.225.80 sridevicovering.com Deutsches Forschungsnetz Berlin, Germany
66.147.240.197 sridevidadithota.com Bluehost Inc. Provo, Utah, USA
68.178.232.100 sridevidentalclinic.com Go Daddy Software, Inc. Scottsdale, Arizona, USA
67.214.166.10 sridevielankaliammanprayampathuthirumazhisai.com Colostore.com South Bend, Indiana, USA
208.91.198.26 srideviengg.com Extremeware Inc. Miami, Florida, USA
192.185.122.74 sridevieyehospital.com Bull HN Information Systems, Inc. Chelmsford, Massachusetts, USA
70.32.89.40 sridevifans.com Media Temple, Inc. Culver City, California, USA
216.21.239.197 sridevifoods.com Register.com, Inc New York, USA
69.167.172.167 sridevigraphics.com Liquid Web, Inc. Lansing, Michigan, USA
67.228.179.100 sridevigroup.org SoftLayer Technologies Inc. Dallas, Texas, USA
68.178.232.100 sridevihealing.com Go Daddy Software, Inc. Scottsdale, Arizona, USA
174.120.4.194 sridevihospital.com ThePlanet.com Internet Services, Inc. Houston, Texas, USA
70.40.214.93 sridevihospitals.com Bluehost Inc. Provo, Utah, USA
192.185.21.193 sridevihousing.com Bull HN Information Systems, Inc. Chelmsford, Massachusetts, USA
75.125.189.194 sridevijewellers.com Everyones Internet Houston, Texas, USA
208.73.210.29 sridevikapoor.com Oversee.net Los Angeles, California, USA
174.132.107.79 sridevikapoor.net ThePlanet.com Internet Services, Inc. Houston, Texas, USA
220.226.186.30 sridevikarumari.com Reliance Infocom Ltd. Thana, Maharashtra, India
174.132.227.82 sridevikarumariamman.com ThePlanet.com Internet Services, Inc. Houston, Texas, USA
174.132.227.82 sridevikarumariamman.org ThePlanet.com Internet Services, Inc. Houston, Texas, USA
Plot IP

Your IP Address is 44.201.94.72