Domain Names: wealthyaffiliaterevi... - wealthyaffiliatesnip...

IP Address Domain ISP Location
74.53.174.242 wealthyaffiliatereviewsforyou.info ThePlanet.com Internet Services, Inc. Houston, Texas, USA
74.53.89.18 wealthyaffiliatereviewsite.com ThePlanet.com Internet Services, Inc. Houston, Texas, USA
64.202.189.170 wealthyaffiliatereviewsite.info Go Daddy Software, Inc. Scottsdale, Arizona, USA
74.220.215.72 wealthyaffiliatereviewss.com Bluehost Inc. Provo, Utah, USA
198.20.229.81 wealthyaffiliatereviewteam.com University Hospital London, Ontario, Canada
174.120.155.222 wealthyaffiliatereviewx.com ThePlanet.com Internet Services, Inc. Houston, Texas, USA
50.116.74.247 wealthyaffiliaterevolution.com Frontier Communications of America, Inc. USA
64.202.189.170 wealthyaffiliateroadmap.com Go Daddy Software, Inc. Scottsdale, Arizona, USA
74.53.174.242 wealthyaffiliaterocks.com ThePlanet.com Internet Services, Inc. Houston, Texas, USA
50.87.153.172 wealthyaffiliates-bonus.com Frontier Communications of America, Inc. USA
72.20.45.66 wealthyaffiliates-review.com Staminus Communications Oxford, Mississippi, USA
79.170.44.106 wealthyaffiliates-university.com Heart Internet Ltd Nottingham, United Kingdom
64.202.189.170 wealthyaffiliates-works.com Go Daddy Software, Inc. Scottsdale, Arizona, USA
216.27.10.16 wealthyaffiliates.com Hosted Solutions, LLC Raleigh, North Carolina, USA
192.185.48.212 wealthyaffiliates.info Bull HN Information Systems, Inc. Chelmsford, Massachusetts, USA
64.182.102.93 wealthyaffiliates.net Mutual Consumer ADSL USA
162.255.119.254 wealthyaffiliates.org imported inetnum object for ACS-5 Canberra, Australian Capital Territory, Australia
74.208.84.181 wealthyaffiliates.us 1&1 Internet Inc. Wayne, Pennsylvania, USA
68.178.232.100 wealthyaffiliates101.com Go Daddy Software, Inc. Scottsdale, Arizona, USA
64.202.189.170 wealthyaffiliatesand.info Go Daddy Software, Inc. Scottsdale, Arizona, USA
192.185.24.242 wealthyaffiliatescam.com Bull HN Information Systems, Inc. Chelmsford, Massachusetts, USA
184.168.221.55 wealthyaffiliatescam.info GoDaddy.com, Inc. Scottsdale, Arizona, USA
184.73.165.76 wealthyaffiliatescam.net Amazon.com, Inc. Seattle, Washington, USA
68.178.232.100 wealthyaffiliatescam.org Go Daddy Software, Inc. Scottsdale, Arizona, USA
174.132.129.194 wealthyaffiliatescamchallenge.com ThePlanet.com Internet Services, Inc. Houston, Texas, USA
72.52.4.120 wealthyaffiliatescamreview.com Prolexic Technologies, Inc. Hollywood, Florida, USA
74.208.175.217 wealthyaffiliatescholars.com 1&1 Internet Inc. Wayne, Pennsylvania, USA
174.120.243.189 wealthyaffiliateschool.com ThePlanet.com Internet Services, Inc. Houston, Texas, USA
64.202.189.170 wealthyaffiliateschool.info Go Daddy Software, Inc. Scottsdale, Arizona, USA
68.178.232.100 wealthyaffiliatesdream.com Go Daddy Software, Inc. Scottsdale, Arizona, USA
74.53.28.18 wealthyaffiliatesecret.com ThePlanet.com Internet Services, Inc. Houston, Texas, USA
216.8.179.24 wealthyaffiliatesecret.info Managed Network Systems Inc. Belle River, Ontario, Canada
67.227.206.136 wealthyaffiliatesecrets.com Liquid Web, Inc. Lansing, Michigan, USA
68.178.232.100 wealthyaffiliatesecrets.info Go Daddy Software, Inc. Scottsdale, Arizona, USA
66.252.1.38 wealthyaffiliatesecretsrevealed.com Creative Internet Techniques Oak Brook, Illinois, USA
74.53.174.242 wealthyaffiliateseducation.com ThePlanet.com Internet Services, Inc. Houston, Texas, USA
64.202.189.170 wealthyaffiliateservices.com Go Daddy Software, Inc. Scottsdale, Arizona, USA
97.74.144.132 wealthyaffiliateserving.com GoDaddy.com, Inc. Scottsdale, Arizona, USA
68.178.232.99 wealthyaffiliatesfanclub.com Go Daddy Software, Inc. Scottsdale, Arizona, USA
184.73.165.76 wealthyaffiliatesforfree.com Amazon.com, Inc. Seattle, Washington, USA
74.53.174.242 wealthyaffiliateshop.info ThePlanet.com Internet Services, Inc. Houston, Texas, USA
68.178.232.99 wealthyaffiliatesignup.com Go Daddy Software, Inc. Scottsdale, Arizona, USA
64.202.189.170 wealthyaffiliatesignup.info Go Daddy Software, Inc. Scottsdale, Arizona, USA
50.63.202.57 wealthyaffiliatesite.com Frontier Communications of America, Inc. USA
74.220.215.207 wealthyaffiliatesite.info Bluehost Inc. Provo, Utah, USA
68.178.232.100 wealthyaffiliatesite.org Go Daddy Software, Inc. Scottsdale, Arizona, USA
50.63.202.84 wealthyaffiliatesmarketing.com Frontier Communications of America, Inc. USA
174.120.136.250 wealthyaffiliatesmarketing.info ThePlanet.com Internet Services, Inc. Houston, Texas, USA
174.120.136.250 wealthyaffiliatesmarketingreviews.info ThePlanet.com Internet Services, Inc. Houston, Texas, USA
74.208.90.221 wealthyaffiliatesmastery.com 1&1 Internet Inc. Wayne, Pennsylvania, USA
174.121.38.99 wealthyaffiliatesneak.com ThePlanet.com Internet Services, Inc. Houston, Texas, USA
74.53.174.242 wealthyaffiliatesnewbie.com ThePlanet.com Internet Services, Inc. Houston, Texas, USA
Plot IP

Your IP Address is 44.192.47.87