| IP Address: | 198.252.98.98 |
|---|---|
| IP Block: | 198.252.96.0 - 255.255.255.255 |
| Reverse DNS: | 198.252.98.98-static.reverse.arandomserver.com |
| Host: | Hawk Host Inc. |
| Location: | Fergus, Ontario, CA |
| Time Zone: | America/Toronto |
| Current Time: | 5:29 PM on May. 2, 2024 |
| Page Load Time: | 0.299 secs. |
| Server Type: | LiteSpeed |
| Date Registered: | Unavailable |
|---|---|
| Date Updated: | Unavailable |
| Date Expires: | Unavailable |
| Registration Length: | (Unavailable) |
| WHOIS Registrar: | Unavailable |
| WHOIS Server: | Unavailable |
| Domain Status: | Unavailable |
| DNS Nameservers: | ns5.hawkhost.com ns6.hawkhost.com |
| Title: | weffriddles.com |
|---|---|
| Description: | Unavailable |
| Category: | Unavailable |
| Keywords: | Unavailable |
| Plot IP Analysis: | The domain weffriddles.com is hosted from IP address 198.252.98.98, having reverse-lookup 198.252.98.98-static.reverse.arandomserver.com and inward-pointing nameservers ns5.hawkhost.com, and ns6.hawkhost.com. Our records show that other domains are hosted from this IP, such as answermanspecialtyservicesllc.com, cheaperenergytogether.org, and literandra.com, among others. The server hosting weffriddles.com is located in a data center in Fergus, Ontario, Canada. |